PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676709246
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family HB-other
Protein Properties Length: 1677aa    MW: 188573 Da    PI: 5.1065
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676709246genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.17.5e-194499257
               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                kR+  t+ qle+Le+++ ++ yps+++r+eL++kl+L++rq ++WF+ rR k+kk
  676709246 44 PKRQMKTPFQLETLEKVYSEETYPSEATRAELSEKLDLSDRQLQMWFCHRRLKDKK 99
               69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-173199IPR009057Homeodomain-like
SuperFamilySSF466893.81E-163399IPR009057Homeodomain-like
PROSITE profilePS5007116.22840100IPR001356Homeobox domain
SMARTSM003897.8E-1842104IPR001356Homeobox domain
PfamPF000461.7E-164499IPR001356Homeobox domain
CDDcd000862.00E-144599No hitNo description
PROSITE profilePS5082717.434544603IPR018501DDT domain
SMARTSM005711.2E-23544603IPR018501DDT domain
PfamPF027913.4E-17545600IPR018501DDT domain
PfamPF050668.8E-16726793IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156121.2E-6932971IPR028942WHIM1 domain
PfamPF156136.0E-1310761148IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1677 aa     Download sequence    Send to blast
MEMGSDEEDQ IRNVGGVDGN NKKKKKVVVV DHSSNSKDSL SAKPKRQMKT PFQLETLEKV  60
YSEETYPSEA TRAELSEKLD LSDRQLQMWF CHRRLKDKKD GQVKKPTKPT SIVPAAALSS  120
VNDLPVTGSV PELDSRSGSA SGSGCSPYSE SRRNFASGSS SSRAELDEYE TMGKAGYEPR  180
LSVMVRRAVV CIEAQLGEPL RDDGPILGME FDPLPPGAFG TPIAMQKHQV HQYESKMYEP  240
HDVRPRRSQA VARSFHEQQS LDDPSSFTPE MYGRYSESHA RGMDYEVSRS KSSSFMHGNG  300
PVPRSYGNAS RNCSTSQQDM PSPIVPSAHG DSFLLERDSS GLRTEDPYLL SDGVRKSNDV  360
HMKGKLNDNR LGRGSGQKDF EKLEIQRKKN EERMRKEMER HERERRKEEE RLMRERIKEE  420
ERLQREQRRE MERREKFLQR ENERAEKKKQ KEEVRREKDA IRRKIAIEKA TARRIAKESM  480
DLIEDEQLEL MDLAATSKGL SSVLQLDHDT LQHLELYRDS LSTFPPKALQ LKMPFTISPW  540
KDSDENVGNL LMVWRFLISF SDVLDLWPFT LDEFIQAFHD YDSRLLGEIH MTLLRSIIRD  600
IEDVARTPFS GIGNNQYTTA NPEGGHPQIV EGAYAWGFDI HSWKKHLNPL TWPEVLRQLG  660
LSSGFGPRLK KKNSRMTNAG DKDEAKGCED IISTIRSGSA AESAFALMRE KGLLAPRKSR  720
HRLTPGTVKF AAFHVLSLEG SKGLTVLELA DKIQKSGLRD LTTSKTPEAS ISVALTRDVK  780
LFERIAPSTY CVRAPYVKDP ADGEAILADA RKKIRAFENG FTGPEDVADL ERDEDFECDI  840
DEDPEVDDLA ALASASKSAD LVEANGLSGK GRETLFCHVK TDIKSEVETG VSSPPASSMK  900
SIVPQSHSEQ RKNAAVCCVE NTNAVVEDSN QGQSWIQGLT EGDYCHLSVE ERLEALVALV  960
GIANEGNSIR AGLEDRLEAA NSLKKQMWAE AQLDNSCMRD VLSKNESTMG VRIIQNSTRE  1020
MDSFDRDPSH LIDETKPLEV VSNDANISQE NCSSKRSRSQ LKSYIGHKAE EVYPYRSLPL  1080
GQDRRHNRYW HFAASASKND PCAGLLFVEL HDGKWRLIDS EEVFDTLVAS LDMRGVRESH  1140
LRIMLQKIEG PFKENACKNI KLARNPSLEE TCVVNHSPAD SMSPSSAVSG SNSDSMVAST  1200
SIRVELGRND IEKENLSKRF NDFQRWMWTE TYSSLPSYAR KYGKKRCELL ATCEVCVASY  1260
ISEYTHCTSC HQKLDMADSS ERKMLNSGSN ASPLPFGMRL LKPLLVFLEA SVPDEALESF  1320
WTEEKRKIWG FRLNASSSPE EILQVLTSLE NAIKKESLSP NFVSAKELLG AAGADDPVSV  1380
DVFPWIPKTV SAVALRLSDL DASIFYVKPE KPEINPEDEK EQISLFPGNS LLKGKGSKEQ  1440
EEQDEVVPNS GKKSNKRRVS FGSGSNRKVK KKKVQGGPSR FVAGKSNVSV DRNLMGVELN  1500
HQVPGRGKRT VRKRPERNDE DNYRLVSRMA DIVRPKSEEV EDEDEEEEEQ TFRDIDEDWA  1560
GETPREMDED WASETPNRVM TPMQVDDESD NSVGVESEDD DDGQFVDYSQ RNKWGLDWNS  1620
NPNEAMEDEE EVVGVEQVGR EDVAEMTESS GDDDVPANNA AANNYDRDSE DYSSSDS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19299RRLKDKKD
214551472KRRVSFGSGSNRKVKKKK
314651472NRKVKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0101550.0AC010155.3 Genomic sequence for Arabidopsis thaliana BAC F3M18 from chromosome I, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006415655.10.0hypothetical protein EUTSA_v10006543mg
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLV4L2Q30.0V4L2Q3_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.1__3015__AT1G28420.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83472236
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1